PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_74671g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 255aa    MW: 28398.8 Da    PI: 8.4264
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_74671g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.1e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l+ +++ +G g+W++ ++  g+ R++k+c+ rw +yl
    MA_74671g0010 14 KGTWSPEEDRRLIAYIRTHGEGRWRSLPKSAGLVRSGKSCRFRWTNYL 61
                     799*****************************99************97 PP

2Myb_DNA-binding49.11.3e-1590133247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+++++E +l+++++ + G++ W++Iar+++ gRt++++k++w +y
    MA_74671g0010  90 GNFSEDENDLIIKLHSLVGNK-WSLIARRLP-GRTDNEIKNYWKSY 133
                      89*******************.*********.***********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-21664IPR009057Homeodomain-like
PROSITE profilePS5129422.295965IPR017930Myb domain
SuperFamilySSF466894.15E-271263IPR009057Homeodomain-like
SMARTSM007178.5E-141363IPR001005SANT/Myb domain
PfamPF002494.5E-141461IPR001005SANT/Myb domain
CDDcd001671.29E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.0E-66588IPR009057Homeodomain-like
PROSITE profilePS5129421.85684138IPR017930Myb domain
SMARTSM007179.0E-1588136IPR001005SANT/Myb domain
PfamPF002494.0E-1490133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2090135IPR009057Homeodomain-like
SuperFamilySSF466894.15E-2791130IPR009057Homeodomain-like
CDDcd001672.79E-1191134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MGRSRSCDST HAKKGTWSPE EDRRLIAYIR THGEGRWRSL PKSAGLVRSG KSCRFRWTNY  60
LRPDLRHGNF SEDENDLIIK LHSLVGNKHG NFSEDENDLI IKLHSLVGNK WSLIARRLPG  120
RTDNEIKNYW KSYIKKKLLR RGLDPQSHRP LCSPHNSSRA APEHQTPAVQ SPGTPEIADF  180
FQQDCLESSP VLPASSNGEE HPDLNLDLCI SLSSNSAIAS NRVTDALDRI VDSNSNSVGG  240
VCCDIGLRVN CGGCC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-20141387108B-MYB
1h8a_C3e-201413827128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028718.15e-68PREDICTED: myb-related protein 308-like
TrEMBLC0JTD61e-106C0JTD6_PICGL; R2R3-MYB transcription factor MYB17
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.14e-64myb domain protein 4